dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

P24091 (Uniprot 2017_06 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (sp|P24091|CHI2_TOBAC) Endochitinase B KW=Complete proteome; Reference proteome OX=4097 OS=Nicotiana tabacum (Common tobacco). GN=CHN50; OC=Nicotianoideae; Nicotianeae; Nicotiana.
Sequence length 324
Sequence
MRLREFTALSSLLFSLLLLSASAEQCGSQAGGARCASGLCCSKFGWCGNTNDYCGPGNCQ
SQCPGGPTPPGGGDLGSIISSSMFDQMLKHRNDNACQGKGFYSYNAFINAARSFPGFGTS
GDTTARKREIAAFFAQTSHETTGGWATAPDGPYAWGYCWLREQGSPGDYCTPSGQWPCAP
GRKYFGRGPIQISHNYNYGPCGRAIGVDLLNNPDLVATDPVISFKSALWFWMTPQSPKPS
CHDVIIGRWQPSSADRAANRLPGFGVITNIINGGLECGRGTDSRVQDRIGFYRRYCSILG
VSPGDNLDCGNQRSFGNGLLVDTM

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]

Gene Ontology (GO)

Predictions (slim version)

Export predictions (based on slim version of GO terms)

Predictions (full version)

Export predictions (based on full version of GO terms)

Jump to [ Top · Protein sequence · Domain architecture · Gene Ontology (GO) ]