dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|121606981|ref|YP_984310.1| (Polaromonas naphthalenivorans CJ2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment sulfate transporter [Polaromonas naphthalenivorans CJ2]
Sequence length 620
Sequence
MKPSNASAAIPFTTLMRRLAERLFGHWVHQLTPATLRADAMAGLLGAVLVLPQGIAFATL
AGLPPEYGLYTAIVPCIIAALFGSSWHVMSGPTNANSLALFAMLSPLAMAFSPMYIQLAL
AVTVMVGVLQWLIGALRLGVLANFISPAVLFGFTSGAALLIAVHALPDFLGLAAAPEHSA
AGVLAHVLTQLPHANPAALAVAGITLAVALGLRRFRRNWPYMLIGLAVATVLAWGWGQWT
AGSATPSSALRTVGAIATPWPRFEVPRISWAQASDLIGLAFALTIVALGQDISIAKTVAL
RSGQRIDANREFRGQGLSNIIGGFFSSYVSCGSMNRSMPNLEAGARTPLSSVFSALLLLG
LVAVSAPVLAQIPMAALAGLLVLVALALLDLKRWRQLFALSRTDFGVALATLVATLTIRL
EMAILLGMLLSLMSFLYRTSRPAMRTMGFDSRGLDRQFVVIDTPDDPGEPPHPTLPECPQ
LKLLRMEGEVYFGATQHVADILHALRSQPNPQKHLLVMAKSMNFIDLAGAELWQAELAAR
RAMGGDLYFHRPRPEVIRMWRKTGFTDVLGPEHQFPDKFTAISTIFGKLDPEICRHCSAR
IFWECRAAPGADDPANQPTT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]