dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|566719505|ref|YP_008919827.1| (Alteromonas macleodii str. 'Aegean Sea MED64')

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment homocysteine synthase [Alteromonas macleodii str. 'Aegean Sea MED64']
Sequence length 605
Sequence
MQSENNYQNTVSTAVDVKNAKVLSPKRNTTKAETTEGLVEEQLSHFGIDASSEYGKALAN
TAHHLYGAHASVMQLWDITSNTLQGLDKEDRVAYFNAKKFLSFQIAKILDTLQNPFRATY
QSLSSGSGSQGHYPLFDNVTALFSATPVVVRTATYVYACTEWVDDAFQGKEFTHQIYSRL
LNPTNISLANAIVDMEAGPYAADYLAWNFNSGMAAIDACLSNVLSHGDVLIVSRNVYGGV
YQLLHDYFARRNRMDIQIAWFDGYDTQSFAKFMQQTKAEYADRLDNGANMHIYLESPCNP
HGYVLDVPGICELAHAQNALVMLDSTLATPVLHQPLQHKNKAARPDYVIHSYTKDLCGSG
ATTAGVVIGEGHRMFQPKGSSVNGVDWSETMFWDVYYIKGAFLDSEKAFDVLNGMKTLEQ
RMMTKVINTQVFTSFLNAHNQIRVNCHALPEHENAGLREKQHTHGWPCTLFTVDMAPANL
PRDVFVRFFDALEPAFSHQVSIGQNNTIVLCPALTSHSELSSDEQKKAGIELTTMRIAMG
TDNVKQLIAHFMLAAKHFIEPHAPGFCEKFMANADIDALYVSVSERVCSQHFSSKASMDS
LMKGA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]