dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|257058096|ref|YP_003135984.1| (Cyanothece sp. PCC 8802)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment tRNA(Ile)-lysidine synthetase [Cyanothece sp. PCC 8802]
Sequence length 326
Sequence
MWTPLHSQLHTTLRQRNLLPKGQRILIAISGGQDSVCLGKLLLDLQSKWGWKIAIGHCDH
RWSYDEGIADHVEKLAQNWGIPFYLKVANNLKETEAAARDWRYQSLIEIAQENDFTEVVT
GHTQSDRAETLLYNLIRGAGTDGLSSLTWQRNLTPNITLVRPLLNISRPETLAFCQQFDL
PIWEDAANENLKYSRNRIRQQLIPYLQTQFNPQVETNLAQTAEVLRAEVEYLETSAKMVL
EQAINEDQTQLNRLILQSVPLALQRRVMRKFLQKISQREPNFEQIEALTQLIDAPRRSRT
SSLPGNFSAEVQGDWIILSGMIKATQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]