dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|257061792|ref|YP_003139680.1| (Cyanothece sp. PCC 8802)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment glutathione synthetase [Cyanothece sp. PCC 8802]
Sequence length 334
Sequence
MKLAFIADPLPRLDPTHDSTVAMMEAAQVAGHEVWITEIHQLNVIEGKAWATLYQVQLTP
ITLQGEKWVAVPNWYAISEGVLMCLEDMDAVFMRKDPPVNVRYIYATYILELINPDKTLV
INSPQGLREANEKMYTLQFYSLMAETVVSRDKAVIRKFVDEKGLAVLKPLGGKAGEGILM
LETSDRNFNSIIEVSTDYGKEPVMVQRFIPEAKDGDKRIILLDGQPIGAVNRVPTGKEFR
GNMAVGGRIEKTKISPREAEICATIASKLQKDGLYFVGIDVIGGYLTEVNVTSPTCIREI
DLLDGTNLGKKVIEWVEKKVNKREEAGGRRQEDG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]