dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|257785056|ref|YP_003180273.1| (Atopobium parvulum DSM 20469)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PTS system lactose/cellobiose-specific transporter subunit IIB [Atopobium parvulum DSM 20469]
Sequence length 104
Sequence
MADYKILLVCSGGISTSLLMKKIEKYAEEHSMDIKVDAVGTASYEDRVSDYDVLLLGPQV
AYRKKQIADSVAIPVAVIAPQDYAFCNVENILKEVDALLGKSNA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]