dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|126465982|ref|YP_001041091.1| (Staphylothermus marinus F1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 50S ribosomal protein L39 [Staphylothermus marinus F1]
Sequence length 51
Sequence
MARNKPLARKLRLAAAYKENRPVPIWVSVKTRLKVRRGFRLRHWRRTKLKV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]