dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|113952750|ref|YP_729771.1| (Synechococcus sp. CC9311)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment septum site-determining protein MinC [Synechococcus sp. CC9311]
Sequence length 237
Sequence
MITSVALTQGTFQTACHRLVLPTNRHIPWQDTLADQLNGLEGKDLELDSGEWLLNCRVLA
AFQAQLEERQCRLLSIKSCNPHTVVSANALGIPAQLMTPQPTDPRPESREEQQAPALLIH
RATLRSGDHLKARHHVLLIGDVNPGAQISAGGNVLIWGRLRGCAHAGVQGDLNARITALQ
LRPLQLRIADLVARGPEEKPQPGLAEEARIVDGEIAIEPADPRSDLTIQELSFDLNN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]