dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|150390570|ref|YP_001320619.1| (Alkaliphilus metalliredigens QYMF)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment glycine betaine ABC transporter substrate-binding protein [Alkaliphilus metalliredigens QYMF]
Sequence length 289
Sequence
MMKMKTLLTLLLVGVLVLAVGCQPADETPGEAAEEMGSVTLGYVSWDSEIASTNVLKVVL
EDLGYDVDMMDVSAALLYQGVAEGDFDLTTAAWLPTTHGDYINQYGAGLDDLGPNLNGTR
IGLVVPSFMDIDSIEDLATGEYAGTQITGIDPGAGIMQATEAAIDEYGLDYELLEGSDAA
MAAALNDAISYDEEVIVTGWTPHWKFASYDLKYLEDPLGIYGSDEDIHTLARVGLEDDMP
EVYAVASNFHWTPDDMAGVMVAISEGMGAEEAARQWVSENQDTVNGWLQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]