dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|123966074|ref|YP_001011155.1| (Prochlorococcus marinus str. MIT 9515)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment FtsH ATP-dependent protease-like protein [Prochlorococcus marinus str. MIT 9515]
Sequence length 637
Sequence
MNQKLKTIILWALPIILVIALSYQFLSTSNVDNLKSNGTTIAPKNTAVARVSYGRFLDYI
KSGRVTSVDIFDGGRNAVVETVDSDLDNKVQRLRVDLPGLTPELINNLKNEGISFDVHPV
KATPPALGILGNLLFPAILIGGLILLARRSNGMPGGPGQAMQFGKSKARFAMDANTGVVF
DDVAGVNEAKEDLEEVVTFLKKPEKFTSVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGV
PFFSLAGSEFVEMFVGVGASRVRDLFKKAKENSPCLIFIDEIDAVGRQRGAGIGGGNDER
EQTLNQLLTEMDGFEGNSGIIIIAATNRPDVLDSALMRPGRFDRQVTVDAPDIKGRLSIL
EVHSKNKTLQEDLTLESIARRTPGFTGADLANLLNEAAILTARRRKKSISILEIDDSVDR
IVAGMEGSPLTDGRSKRLIAYHEVGHAIIGSLVKAHDPVQKVTVIPRGQAKGLTWFTPDD
DQSLISRANLKARIMGALGGRAAEDVVFGRGEITTGAGGDFQQVAQMARQMVTRFGMSDL
GPIALESGNQEVFVGRDLMTRSEVSDSISKQIDESVRVMVKDCYKETYSIISKNREAMDK
LVDLLIERETLDGEEFVKILSEFTTVPEKERTPQLLN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]