dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

OGLUM01G45160.1 (Oryza glumaepatula 22)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel chromosome:ALNU02000000:1:42580856:42584263:-1 gene:OGLUM01G45160 transcript:OGLUM01G45160.1 description:""
Sequence length 673
Sequence
MVELIKVPKIEQEEGNADSHGKEKADVVHEEKTEKVKRRRKRVSDPQRKKACVDCTKRCI
RIHGMASSSSEKARPTPTLPSFFKIMVGYFSENMDIPLPFARTITDMTGSNVYLEDAYGL
RWRVRLYLHDDVLSFGHGWKNFVLDHDISVGEFLVFRQIARSVFTVQIFAISACERIHLC
ERNKRQSRKRKPGRKTGYPANNQMVKVSSKDVVKRRKKQRTDEQIYDLDPRQHDMPVRVC
IDSGSELRCSESSVKELDAAPDKSHAVVQVPATECNADPSYNAAGMKTIKNLEAIGASSS
TKDVTWDANKSEDYPSFSYPESSNVMTADKESERSHQDRPMQLYCELGLEDGNAETDNCE
NSNVLENAELRTPLAMMDLNEVGIDDIFLSADIYEFDSDFCSPEAFSVDVNTEGLVANGR
TPGDCFGMPETSRCLENKQMTDVPRTSTDDGSIAVHGIDINALPSNTYPDIGQGNTYPDI
DAAPDDCKKDKDVLHSECNKVAQKAHSSVKQDITKDGPRQIAAEIMSSGPKTCELTYVRK
NSVQPGTSSVSQWNNSKGQESGGTKSCVVLAVAANSKKFCITIPPPDQTWLELPRRLPVL
PRTKKQARKILILKDPSMRLWPVLYQCTPKFNGFIAGWADISRENNLREGDTCEFELCSN
SELSFQVLVPNLQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]