dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|239826517|ref|YP_002949141.1| (Geobacillus sp. WCH70)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment stage V sporulation protein D [Geobacillus sp. WCH70]
Sequence length 646
Sequence
MRVSHVTVRKRLMIVFLVGVFIFAIIDIRLGYVQFILGDMLTERAKDSWSRNIPFEPKRG
EILDRNGVPLATNMSAPTVYVIPRQIENPAETAEKLAKVLNMPVEKAYKHITKKTSIERI
PEGRKISNEKAKEIRALGLKGVYIAEDTKRYYPFGSYLSHVLGFTGIDNQGLTGLELYYD
KELSGQRGSVQFYSDAKGKRMPNMADDYTPPTDGLNLVLTIDSRIQTIVERELDIAEAKY
NPDGIIAIAMNPNTGEILAMASRPTFDPANYRTVPPEIYNRNLPIWSTYEPGSTFKIITL
AAALEEKKVNLLKDHFYDPGYVKVAGATLRCWKKGGHGSQTFLEVVQNSCNPGFVELGER
LGKERLFEYIKKFGFGEKTGIDLQGEGTGILFDLKRVGPVEQATTAFGQGVSVTPIQQVA
AVSAAVNGGILYTPYIAKQWVDPETGKVVSRNTLKAKRRVISEETSKQIRYALESVVAQG
TGKGAYVEGYRVGGKTGTAQKAKGGRYLKDNHIVSFIGFAPADDPQLVVYVAVDNPKGTV
QFGGVVSAPIVGKIMEDSLRTLGVKPRKGQIEKERAWNDPKMVEVPNLIGLSKKDLQEQL
FNLKLDVSGEGDVVIEQAPEPGVKVKEGSTIRIYLASKMSSKKEVR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]