dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|258541800|ref|YP_003187233.1| (Acetobacter pasteurianus IFO 3283-01)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Acetobacter pasteurianus IFO 3283-01]
Sequence length 1241
Sequence
MSGGNNHYEAKTTCTHGRPGSGSPIRNEKPMSSTDTFAPDFASRTPLRQAIIEAMRRPEA
QCVETLTPDATLTEAQNGSVASMAAKLAEALRARRSPGLVETLVQEFSLSSTEGVALMCL
AEALLRIPDVATRDALIQDKIGESNWLSHVARGKPLFANAAAWGLALTGKLVTEHDEGTL
ASSLLNFAERTSKPIIRKAVDAAMRLMGEQFVLGQTIDQARKNSAKLEAVGFSYSYDMLG
EAAFTAHDAERYRQDYINAINTIGRSATGNNVYDRPGISIKLSALHPRYARAQYDRVMGE
LLPVVQELTLLARKYDIGLNIDAEETERLDVSLDILEALCATPGLEGWNGIGFVVQAYGK
RCPYVLDYIIDLARRTNRRIMVRLVKGAYWDSEIKKAQVEGMADFPVYTRKCHTDISYIA
CARKLLNARDVIFPQFATHNARTLSTIYTLAGEKFELGSYEFQCLHGMGEPLYKQVVGAD
KFNRPCRIYAPVGTHETLLAYLVRRLLENGANSSFVNQIGDSAIPLSSLIENPIDVARCY
TPYGAPHTEIRNPRDLFAPERINSAGVDLADDKVLSALATGIKDAPQTWEASPMVVGVKK
KGAFRPVTNPADRRDVVGKVSYATPDVVRKAVDAAQKGQQDWANRSPAERADILQKASDI
LEERTDDLLALLGREAGKSLPNAVAEVREAVDFLRYYGATIRRDFDNTTHKPLGIVTCIS
PWNFPLAIFIGQIAAALAAGNVVLAKPAEETPLVAAVAVGILQEAGVPPAALQLLTGEGD
VGAAAVADERVMGVMFTGSTTVAQIINRQLLERRTATGQPVPFVAETGGQNAMIVDSSAL
AEQVVADVLASAFDSAGQRCSALRVLCVQEDCADHVLAMLRGAMRELRIGNPAHLSCDVG
PVITEEAAANITAHVNAFKARKAPVMALPVPEACANGSYVPPTLIEVLNIREIGPEVFGP
VLHVLRFERDKMEELLLEINDTGYGLTFGLHTRLDSTIKSVLSQVEAGNLYVNRNTIGAV
VGVQPFGGRGLSGTGPKAGGPLILRRLLSEAPTVAQIVRGRTMPEMAQWTDWLREKGESK
AAQIAGNLARLPLVGGEITLPGPVGEQNIYRLSARGNVLCVPITLAGLYDQISLALAGGN
TALVLAEEELTGWLDRLPDILRQAIRPVASATALPCSILLGEDDNAIFRSARRTLAEANG
PIVSAFVTGTTLPSVEVVLEEQSRSINTTAAGGNASLMTLN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]