dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|153001815|ref|YP_001367496.1| (Shewanella baltica OS185)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Shew185_3306 [Shewanella baltica OS185]
Sequence length 291
Sequence
MSDDIPPSTNAHKKGWFDRVSQLFQGEPQNREDLVDVIDGAEQRDLITQDTREMIKGVLD
VSDMRVRDIMIPRAQIVALQIDNSVEELLATVIGSGHSRFPVVNEDKDHIEGILLAKDLI
PYGFSNSDEPFSLDRVIRPAVVVPESKRVDVLLKEFRSQRYHMAIVVDEYGGVSGLVTIE
DILEEIVGEIEDEFDHDSTEETEIRKVGNTVYMVKALTPIEDFNEEFNTEFSDEEFDTVG
GLVSHAFGHLPERNESIIIEGIEFKVINADTRRLIQLRVKLPDPNTGEDVE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]