dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|146297106|ref|YP_001180877.1| (Caldicellulosiruptor saccharolyticus DSM 8903)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein [Caldicellulosiruptor saccharolyticus DSM 8903]
Sequence length 138
Sequence
MKDKYIFPAIFEPAEKEGYVVTFPDLPGCITEGKNLEEALYMAKEALELHIFGLEEDGEE
IPEPTPPEKLNVSKGAFVVPIIAYMPPVREEMANKSVNKTVTLPRWLSRAAEEAHINFSQ
VLQQALKEKLGIKERKNA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]