dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|479202402|ref|YP_007830993.1| (Roseburia intestinalis)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Predicted aminopeptidase, Iap family [Roseburia intestinalis M50/1]
Sequence length 671
Sequence
MQEAVIKNIDTDYSYQLAKRMEQFHSNEKLGYRPAGSKAEFLTGEMLKDEMQKLGLSDVC
KNAVTVDGWEFENAELTFETKEGKRHTALLGAYQTDFVTDGEQAFSLMYLGKGTEADYEG
KDVTGKLVLVDINQRDEWWINYPVYQAHLKGAAAVIAVQCGGYGEVDAKALNAQDIAGPE
DAPAFSISREDAALLRELLDGEKEATVWLKADSRVKRDCTTYNISGCIPGKHPERMVLLS
AHYDSYFSGFQDDNTAVAMMFGIAKTLIESGFKPNNTIVFCAMAAEEWGVVDSNFDWSTG
AYEQIFTAHPEWVGKVIADLNFELPALAHGTRARIRCCYEYVHYIKEYLDGLPELTKAYP
EMTSVTAPIETWSDDFSMAIAGIPSMVNDFTGGSFMETHYHSQFDNDDFYDEAVYRLHHE
LFTLLILALDETAVVPLDFTPVLERILAGGSEITAKVEETQEQIAAITKKLIQVTEEAQE
KAKQSYEETAAINTRYYALLAEGNMQEAEQLFAENREREKQLLVKFKQEQDHFVRIDWYG
EVFFPHEILWKNIGLLQDSVNALEQSDVDKALEKIYQVDNNAYAFMFDEYVYRHFTDYVF
NQPKDRLKWGYGRLLGHEDLYHVVKCLLKKRKEADTDYREELHYLKECYKKQTRRLCETL
KEISQTVKEMF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]