dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|126179126|ref|YP_001047091.1| (Methanoculleus marisnigri JR1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment NADH dehydrogenase I, subunit N related protein [Methanoculleus marisnigri JR1]
Sequence length 222
Sequence
MFDLPTANIGGPDLFVLEFGDIVAYFSPYTAALFVFALIFTVLVIVSRPERQVDIAFGGD
AYYTKVVDPDLLRFQRFMAIACGLATLGAVVTGDVFNFTLFASMVGITNIGIVAAYRNRH
VLNAAFQYGIVAMLATVPLFGGAAIVLAGTGTLSMWELFGGAMAVPLIAKAFLVLGVMGE
GMAPFYIAKAEITRAQGAPFILMVHVSSLLLFLRVTEIVISM

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]