dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|256825890|ref|YP_003149850.1| (Kytococcus sedentarius DSM 20547)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment translation elongation factor 2 (EF-2/EF-G) [Kytococcus sedentarius DSM 20547]
Sequence length 702
Sequence
MAQDVLTDLKQVRNIGIMAHIDAGKTTTTERILFYTGVNHKMGETHDGASTTDWMEQEKE
RGITITSAAVTSFWKGTQINLIDTPGHVDFTVEVERNLRVLDGAVAVFDGKEGVEPQSET
VWRQADKYGVPRMCFINKMDKMGADFYYSVQTMVDRLGANPLVMQLPIGAESDFIGMVDL
VTMKAFTWSKETPLGEAYQIEEIPADLQDKADEYRAALVEKVAESDEALLEKYLGGEDLT
EDEIRAGVRTLTLAGEVNPVFCGTAFKNKGVQPLLDAVVAYLPSPVDLPPIEGHLPGDEE
NVVLRKPSSDEPFAALAFKIATHPFFGTLTYIRVYSGEITSGSAVLNATKGKKERLGKLF
QMHANKENPVEKVSAGHIYAVIGLKDTTTGDTLSSPEKPAVLESMTFPAPVIHVAIEPKT
KGDQEKLSTAIQKLAEEDPTFTVNLDEDTGQTVIGGMGELHLDILVDRMKREFKVEANVG
APQVAYRETIRGTVDKLDYTHKKQTGGSGQFAKVQLKFEPLEQGDEDAALYEFENAVTGG
RVPREYIPSVDQGIQEAMQLGVLAGYPLVGIKATLLDGAYHDVDSSEMAFKIAGSMALKE
AVRKANPVLLEPMMAVEVRTPEEYMGDVIGDINSRRGTIQSMEDASGAKVVRGTVPLSEM
FGYVGDLRSKTQGRANYSMQFDSYGEVPKSVAEEIVKKVRGE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]