dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|225872265|ref|YP_002753720.1| (Acidobacterium capsulatum ATCC 51196)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment glycyl-tRNA synthetase subunit alpha [Acidobacterium capsulatum ATCC 51196]
Sequence length 345
Sequence
MASAPKNHSQSKPLTFQEVLFRLQSYWAERGCVLQQPYDVEVGAGTMSPDTFLRVLGPEP
INIAYAQPSRRPADGRYGENPNRLYKHTQLQVILKPPPADIQDLYLKSLEAIGIDLREHD
IKFEEDNWEWPVGGAWGVGWQVMLDGLEITQFTYFQQCGGMDLDPISGEITYGLERLCAF
LQDVDSIYDIVWARDPRNGREVTYGEIRLQEELQLSVYNFEAADIGKLWEHLRLYEAECQ
ALLANFHESFSPKAEKKAERHEKIHERVVHDGAGVPASEDVVQSLRRFPVLGAYELCLKC
SHLFNLLDARGAISVTERVAVMARIRNMVVGVAKAYRQQSVGLSA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]