dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|225873931|ref|YP_002755390.1| (Acidobacterium capsulatum ATCC 51196)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment aspartate--tRNA ligase [Acidobacterium capsulatum ATCC 51196]
Sequence length 610
Sequence
MLDFLGTKQRTHTCGELRAAHAGETITIMGWVNRRRDHGNLIFLDLRDRYGITQVVLDKD
LSAEAHAKAEQARPEYVICATGKVRARSQEAINPKMPTGEIEIAATELLILNDSKVPPFS
PAEEAIANEEVRLKYRYLDLRRPEMQHNFEVRHKVALAVRQYLSGQGFFEVETPFMTRST
PEGARDYLVPSRVHPGEFYALPQSPQLFKQILMISGMDRYFQIARCFRDEDLRADRQPEF
TQIDLEMTFPQQETIFGVVEGFLAAAFEAVGQQITVPFPRMTYDKAIELYGIDKPDLRLP
PMTDVRSVFSDEELQSLKIEPGMPIVAIVIPNKSAMSNTQKKAFGKEVEEQVGAELAYLD
VERLRTSPQFALLADRIDAAAAAHCKLERVEPDHRLVVISPRLGAAAVSRDTSWVYKRAG
QLRLELGKRFAAEHKAFEKKGTAADYQFLWVTDFPFFEWDEQSHTWTFAHHPFTSPHQDD
LIAGRLESDQAAVRALAYDVVLNGTELGSGSIRIHRQDVQQQIFRALGMSDDEAKERFGF
FLEALQYGTPPHGGIALGLDRIVMILAGASSLREVIAFPKTAKAIDLMVDAPTPVSDAQL
RELHIRPTKQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]