dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|220907356|ref|YP_002482667.1| (Cyanothece sp. PCC 7425)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment anti-sigma-factor antagonist [Cyanothece sp. PCC 7425]
Sequence length 114
Sequence
MSLRGSRELRDTYQLFRLTGLMDAFSEPMFRKVLNKYIEDGPPHIILDLSKIDFVDSSGL
GVLVQLAKKAQTSGGSLQIVTNPRVTQTVKLVRLEKFLALQPDLDTAISNVPQG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]