dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|258513426|ref|YP_003189648.1| (Desulfotomaculum acetoxidans DSM 771)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 50S ribosomal protein L31 [Desulfotomaculum acetoxidans DSM 771]
Sequence length 68
Sequence
MLKSGIHPEYRTIKVKCVCGNEFNTGSVRKEDLRVEICSNCHPFYTGTQRTIETGGRAER
FRKKYGIS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]