dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|258516481|ref|YP_003192703.1| (Desulfotomaculum acetoxidans DSM 771)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ABC-type nitrate/sulfonate/bicarbonate transport systems periplasmic components-like protein [Desulfotomaculum acetoxidans DSM 771]
Sequence length 364
Sequence
MRLHKRTLVIIAAFAIFIITPALYFYFNKLHKTAAADTLPVIEDCRSLSGLPQYIAMKKG
YFEEQNLKIELKTASTSQELHEAVKTKKRSIVLCGSETIVNYLSQDSCNMMVFAGLTDRE
DSFLLGRPDVSEFTKEKVRGNSIIVSSPDSLQSMVLENILREKKIWPNYEVNLMQNLPDN
LKRGAFKSGTATFIVLTEPEATLLETAREAKTLLAFAAAGGELPAVVLACDKQLLLSKPQ
TVQKYTNAVYKAILWINCHNTGDIVALIKEFYPNTDQKLLISAVNRYKDLSIWTETPVIT
QKSYENLLNIMENSGELTRPKKYNDVIDNRFATEAVQSITYTPEEEQKKGFFNTIFKHFN
FWQR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]