dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|154246770|ref|YP_001417728.1| (Xanthobacter autotrophicus Py2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 5,10-methylenetetrahydrofolate reductase [Xanthobacter autotrophicus Py2]
Sequence length 317
Sequence
MTTPALAPAPAPVRASREMDRPPVKVSFEFFPPKSPEMEKTLWSSIARLAPLSPDFVSVT
YGAGGSTRERTHATVERIAKETDLAPAAHLTCVAATRDEIDAVVRAYGEAGVKHIVALRG
DPVTGVGTRYEPHPGGYAYANDLVAGIKRIGDFEVSVSAYPEKHPESASLDADIDVLKAK
VDAGATRAITQFFFENDVYFRYLDKVRARGIDIPIVPGILPVTNFKQASSFATRTGASVP
AWLLRRFEGLDDDVETRKLIAAAVAAEQVTDLVDRGVTDIHFYTLNRADLVYAICHLLGL
RPKVAGALADAPKAVAI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]