dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|154247377|ref|YP_001418335.1| (Xanthobacter autotrophicus Py2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Xanthobacter autotrophicus Py2]
Sequence length 1221
Sequence
MIPAVAAPWAVPETAPLFAEFAPRSSPPLPLRAAFAAAHRRPERAAVADLLPAARLPPEL
RERIAARAGDLVTRLRARPRGSVVAALVQEYALSSQEGVALMCLAEALLRIPDSATRDAL
IRDKIGHGDWQAHLGGGRSLFVNAATWGLVLTGRLTATADDGRLSSALTRLVARCGEPLI
RRAVDMAIGLMGAEFVMGRTIEEALHRAGRREAQGFSYSFDMLGEAAMTAADAERYFAAY
AAAIEAIGKAAGGRGIHAGPGISVKLSALHPRYARAKAGRVMAELLPRLQRLALLARRHD
IGLNIDAEEQDRLELSLDLLEALAAHPGLAGWNGIGFVVQAYGKRCPAVLDFIIDLARRT
GRRIMVRLVKGAYWDAEIKRAQVDGMADFPVFTRKVHTDLCYIACARKLLAARDAVFPQF
ATHNAQTLAAIYELAGPDFRVGDYEFQCLHGMGEALYEEVVGPLTRPCRIYAPVGTHETL
LAYLVRRLLENGANSSFVHRLADDSVPLAELIADPAETVAAMADPGAPSPAIAAPRDLYG
SRANSAGLDLSSDAVLAALGETLAASRETPWRAQPAGGGGPARVVRNPGDHRDVVGEVRE
AGAEDVARAVAVARGAAPGWAARTPAERAAPLRAAADMLEAQMPHLLGLIMREAGKSAAN
AVAEVREAVDFLRYYADEATARLTAAHRPLGPVACISPWNFPLAIFTGQVAAALAAGNCV
LAKPAEETPLVAAEAVRLLHAAGIPQDVLQLLPGDGVVGAALVEAPEVAGVMFTGSTQVA
RAIAGVLACRLSPTGRPVPLIAETGGQNAMIVDSSALPEQVVADVLASAFDSAGQRCSAL
RVLCLQEEVADAMLAMLKGAMAELEIGRTDRLAVDVGPVITAEARAGIEGHVAAMAARGF
PIHRLPLPVEAANGTFVAPTLIEISSMADLTHEVFGPVLHVLRWRRADLGRLVDDINATG
YGLTFGLHTRLDETIAAVTGKVQAGNLYVNRNMIGAVVGVQPFGGHGLSGTGPKAGGPLY
LSRLVTGPAFALGAGTADHAALAFADWLDERGRADDGAAVRALAQVVPLGLSLDLPGPAG
ERNTWRLRPRGSLLLLPASERGLMRQIGMALATGNRAVVEAEAGLLSQLADLPPAVAARI
RTEGGDGPFAAALAEGEGARLVAVAQRLAALPGPIVPLHGATGEEIAASPFAFPAHLLLE
EVSLSVNSAAAGGNASLLAVA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]