dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|390961030|ref|YP_006424864.1| (Thermococcus sp. CL1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 2'-5' RNA ligase [Thermococcus sp. CL1]
Sequence length 184
Sequence
MRAFIAIEVSDEVRDNLLKAQERIGSKSAKIKFVERENFHVTLKFLGEIDEITAEEVKRA
LEEIAKKHKKHRVRVKGIGVFPNPNYVRVIWAGIENDEGIKAIARDVEREMRRLGFKKEK
DFVAHITIGRVKFVRDKLELAMALKDLANEDFGEFDVEAIELKKSTLTPKGPIYETVARF
ELAE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]