dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|110800698|ref|YP_696823.1| (Clostridium perfringens ATCC 13124)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Maf-like protein [Clostridium perfringens ATCC 13124]
Sequence length 192
Sequence
MKVILASKSPRRVEILEKIVKEFEVVQSNFDENTIDFKGDIEKYVKDLSRNKAIEVSKRL
NEPSIVIAADTVVFQNGKVLEKPKNEEDAFSMLSSLSGNTHKVYSGICLINTYDDTVVTD
CDCTEVRFSELNPRQIRNYINSGEPMDKAGAYGIQGLGGAFVEGIKGCYYNVMGLPLNKL
YKALENYDITIL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]