dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|150378197|ref|YP_001314792.1| (Sinorhizobium medicae WSM419)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment NoeB host specific nodulation protein [Sinorhizobium medicae WSM419]
Sequence length 553
Sequence
MKRIVLLLSPLVILLSPIIDAFQGVYIDPRSDAGYAVIACVAIIGLALGMIATFCYKRGA
VGNVVTAGTLAVTLFLFGDLSYGVFWRLADHIGMGGAAALAFAGLVVLILVLFKLMAAVP
RMMAAFAVALLGSTVLDRGLITEASAEESAPAVIYIVTDEMIGISGIDTRLPHGAEAKAA
LSRVFQKHGFRLHSKAFSRHILTQVSVPAALNMDYSYNFPGDRSHYAYPGEVTKFKELSL
FNLWHRQGLSVNVFQSAHLDYCKTEALVDCHTFASFDGSRFIQRQRIEGGPYRDVPPASA
SLADVKALIEGNRQSLAMAAVGFVASNLLETKETALQEWHPRSYDQLAFPYWLGQFQNMI
LDKGRGNAFFAHFLFPHSPSVYNKDCKPTNRWVERSYLTEVRGLAGQELDEARVKEYGFY
FAQTLCLAKQLDKFFNAVLSDKRFQDATIVVHGDHGSRISAGRNVETMSPRDYVDNYSAL
YAVRKPGVATGTDYRLHSVQWLNASLFRGNVSEVAPTVVGSMQSKSDDSALYAPITDPDH
VAIMPMHDFDASH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]