dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|257068290|ref|YP_003154545.1| (Brachybacterium faecium DSM 4810)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ABC-type dipeptide/oligopeptide/nickel transporter permease [Brachybacterium faecium DSM 4810]
Sequence length 318
Sequence
MRSDAAPTRRPRSEHWVAPLEETPLQAVDAADTSTAPRSLWAEAGHSLVRNPVFVVSALL
ILFVLFVAAFPQVFTSQDPRYADLTTANQPPGAGHPFGTSRLGYDIMARTFWGARTSVVI
GFFAMIGSTLIGGTIGALAGYLGGWFDEVISRVTDVFFAIPLILGAIVVYTRLGEMNLWT
VIAVLSVFGWTNVARIMRGAVISTKSQDFVTSSIALGASSPTVLLKHVIPNAIAPVIVTA
TVNLGVFIVAEATLSFLGVGLPTSAVSWGGDISAARDALRTQPSMLFYPSVALAVTVLSF
IMLGDAVRDALDPKARKR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]