dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|238922208|ref|YP_002935722.1| (Eubacterium eligens ATCC 27750)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein EUBELI_20443 [Eubacterium eligens ATCC 27750]
Sequence length 112
Sequence
MEVVNVAIATNILQCLIPISQFNKGQASKIFDRLHDEKELIVLKNNQPSAVILSPEEYTR
LTEIEEDYYLLIEATKRIEDNGNKETVSMDYVMRNLGIDEKELENAEDIDIE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]