dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|257052114|ref|YP_003129947.1| (Halorhabdus utahensis DSM 12940)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Huta_1031 [Halorhabdus utahensis DSM 12940]
Sequence length 137
Sequence
MPVLLNDHDSDLTLRPGTTKSDIVAYLYRNPEWGYSPKDITEALDIPRGTATTTLKRLYD
DDYVGKTDDGYYHALGERDDIRRYVSSLEQAHRLFGHHRDADATPEAPEKQIAADRTDEK
TDAELAALEDEIGDHDE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]