dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|224368032|ref|YP_002602195.1| (Desulfobacterium autotrophicum HRM2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment putative acetyl-CoA hydrolase (acetyl-CoA hydrolase/transferase family protein) [Desulfobacterium autotrophicum HRM2]
Sequence length 724
Sequence
MSKKQPVYFTDVEQCVDDLIGQVGKEIILAAPLALAKPTQLINAIYRRLKTDPELHFTLV
TAVALEKPTWSSELEHRFLGPLVERIWGGFIDFDYVLDMRKGQIPPNFELVEFFNKAGGW
MTNAHAAQNYLGSNYTHAVRDAVINRCNVLSQLVAKQEINGKILFSMSSNPDTHLEGAKV
MRDMRAKGEKVAIIAQVNTNLPFMYGKAVVEPGFYDMVIDSPDLDFTLFGAPKEPINNVD
WMIGLHASTLVRDGGTIQVGIGSLGDAIVAGLDMRHRENKAYCDFLTQADILSKFNPLIQ
TIGGTDVFKTGLLGSSEMFVDSLLELIKAGIIKRKVYEDVRLQKLLNQKRFEDTQIEDIF
REFVAQRMLHPVIKESEVGFLKHFGIFHPDVTYVDRSIRLGQTEYSLDMRIAKNVEAVAL
NCLGPCLKNGVVLYASFFIGPQAFYTELREMDDDQLKLIDMRGVDYVNQLYGNEALKRLQ
RVHGRFINAGIMVTLSGAVCAGGLEDNKIISGPGGQYNFVAMAHALDDGRAVTMIRSTRE
AGSKTTSNVVWQYGHITIPRHLRDIVVTEYGIADLRGARDREAMTRLICIADSRFQEELL
DKAKAAGKIPRDWQIPEPFTNNTPQALEEKLAAFRKKGFFKSFPFGTDFTDEEIVLGRAL
RQFKQKAEENKFAIMPGLIGQGLSSIPKTARPYLERMGLEDPETMQEKLMQKIVLFALKS
SGAI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]