dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|134302270|ref|YP_001122239.1| (Francisella tularensis subsp. tularensis WY96-3418)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment aspartate aminotransferase [Francisella tularensis subsp. tularensis WY96-3418]
Sequence length 528
Sequence
MSQQDLSPFEFKDELIKLATSKADRLMLNAGRGNPNFLATIPRHAFLRLGDFALRESERS
YSYLNNVFGGLPEKKGITERFDYYCLAHDKQDGIDFLRAAISFVDDYLGINKEEFLYEMT
NAYLGCDYPSPPRILPIIEKIVMHYLREELYQNIDTPLEFDIFATEGGTAAMTYIFQSAK
INGLLNAHDKIAMITPIFSPYLEIPELPEYNNPIVHIYADEKVHWQVTDKELEKLLDPTI
KILCLVNPSNPPSVKISDLVLEKIAYIIDNHRSDLMIITDDVYATFSDDFESLFSKCAYN
TLCVYSFSKYFGATGWRIGTIALHKDNIFDKLISNLDDKKLDELDKHYSSLTTDSRTLKF
IDRLVADSRSVALNHTAGISLPQQLQMGLFALSSLLDNQNIYRKEAKDLIRRRYNILYSS
ISPKLQQSLDENNVGYYTLLDLEELSYKIYDKDFSQWLIKNHSGPETLKILATETGIVLL
PGKGFDVLHPSARVSLANLREYDYRQIGISIRQQLDNLYSQYKKQTKD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]