dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|114326774|ref|YP_743931.1| (Granulibacter bethesdensis CGDNIH1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Granulibacter bethesdensis CGDNIH1]
Sequence length 1237
Sequence
MIQHGGLAMTRSGLFIDLAQAFGTVTEARHRLDRACRHPEQDCVASLLPLASLSDHAASQ
ADTLARSLAERLREHGPGNGLSALIQEYDLSSQEGVALMCLAEALLRIPDDGTRDALIRD
KIGRGEWHTHLGWTRPLFVNAATWSLVLTGRLVAPSSASTLGAALTRLIGRAGEPVIRHA
MDRVVRLLGTRFVAGETIEAALAATSLLWTQGFRHSYDMLGEAAMTRADADRYYRAYEHA
IDCIGATLRARGYEPAEDMTALLEAPSISIKLSALHPRYEHTQHARIMQDLPPLLRNLAA
MARANGIALTIDAEEADRLPLSLDVLAALCADPVVAGWNGIGLAVQAYQRRAPAVIENLI
DLARHHDRRLMIRLVKGAYWDSEIKRAQIDGLESFPVFTRKSYTDLSYVACARMLLEAPD
AVFPQFATHNARTVATIIAMAEEITGVSFNPGQYEFQCLHGMGETLYADVVRPDGLNRPC
RIYAPVGNHETLLAYLVRRLLENGANTSFVNRVADTAISIDQLIADPVQQILAMRTECGV
PHPKIRSPRSLYGPERENAWGIDLTDATRMAQLAEACITLSSKRWLVSIEEDADRERISI
RNPAASWDHIGDVVFATAEEADRAIARARQAAPSWAAEPPSRRAACLRDAADAMERDVAL
FINLAVREAGKTIPNAIGEVREAVDFLRYYAAGIENGWNAQTHPPLGVVTCISPWNFPLA
IFTGQVAAALAAGNAVLAKPAEETPLIAAEAVAVLHRAGVPTAVLQLVPGDGAVGARLVA
DSRVNGVVFTGSTEAARFIQRSLSYRLNTHGDPVPLIAETGGQNAMIVDSTALPEQVVSD
VLVSAFDSAGQRCSALRVLCLQDDIADLVITMLRGALQERVTARPDRLDTDIGPVISAAA
RDAIEDHIAAMARAGCTMHRAALRQETEDGFFVAPTIIELGSHPIPDKEVFGPVLHVLRF
RRDDLSDVIARINATGYALTFGIHSRIQETVDHARMKSTAGNIYVNRSMIGAVVGVQPFG
GHGLSGTGPKAGGPLYLSRLVEHEPLSPVKQFFIEKEKNAVPASIKIWQVWIQQQGIEPL
SLPILRYDRDMVLPGPVGEQNIYRLSPRSSLLCIASDLERLSYLVQSALAAGIKHIAVSI
PADITYVFNTLPDALRSTVVLAAPDQEDSADTVLFEGDDAALIALQTRLAHQSGRIVPVY
RIRRRGRDIPLLALVAECTISINTAAAGGNAALMAMA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]