dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|154150744|ref|YP_001404362.1| (Methanoregula boonei 6A8)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment peptidase M42 family protein [Methanoregula boonei 6A8]
Sequence length 345
Sequence
MVKELLRKLSNAHGVSGSEGSVFALIKKELKGCVDEITEDPMGNLIAVRHGNKSKVMLAA
HMDEIGLMVKYIDDKGFLRFITLGGWYGPTLYNQRVIVHGTKGDRIGVIGGKPPHMMDED
ERKKGVKTDDMFIDIGAKNKDDVAELGIEVGTPVTIDREFTELANNRVTGKAFDNRAGVA
MLIKTMQKMKSPFTVYAVFTVQEEVGLKGAKTSAYTIDPDWAIATDVTIPGDHPGIDMKD
AAVEMGKGPVITIVDSSGRGLIASRKVVQWLKNAAETNAIPVQYEVGTGGTTDATSIHLS
RGGVPSTTISPPTRYIHSPVEVLDTGDIEAGVNLLVAALKTKPAL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]