dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|148543821|ref|YP_001271191.1| (Lactobacillus reuteri DSM 20016)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment peptidoglycan glycosyltransferase [Lactobacillus reuteri DSM 20016]
Sequence length 719
Sequence
MNKKPQRTKNRGHRENRGTFGKWLFLITVGLFTLFIVRFAYIAINKDVQHVNLRSQAEQI
YTQQRIIQARRGDIYDSEGNPLATDTSKYTLYAVLDRTQKSSDGKPLYVKDRKKTAKVLS
QYIDLTPKQIEKILKPKGQAYQVEFGNAGSNLSVSTMQKIKNRHLPGINFIATPARQYPE
GEFASQIIGMATPKVKNDNGTEETNLVGQLGLEGYFNKQLTGINGLRKDKQDVYGYQIAN
SKQVTKKAINGDNIYTTLDSQTQHFLENKVNKVYKSSNANAMTAVVMEAKTGKIIAATQR
PTLHAENNPVWRNMLVQDAYEPGSVMKILSLAAAIDTGHFNPNATFNSGTWTMGGGKITD
WSSSGWGTISYKDAFDMSSNVGFAHVEQDMGAETWMKYIKRFGLLKKVNVIGMSNEVNGY
TSFKGILAQANTAFGQGITVNVMQMMQAFSAIGNNGKMMKPYIVSKVVDGNSGKTIQKVK
PKVVGQPIKASTAKKVLGYMQGVVYDQKGLGHDYQIKGYRIAGKTATAQIGGAHGYSTGD
TNYLYSFAGMAPAKNPKYIMYVTLRQPQNLKKPATKQIASVFNPTMKMLLSQQKVAEKAK
KKVITMPNVVGQASDEANKELSGKGMQVIVVGSGKKVKQQSAVPDEQVLTDQHVILDTGG
EYKMPDISGWSSADVQQLAKVLKLKVKENGNGYVTQQSISPDTTIKRGTTLTVQYEAKN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]