dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|222479855|ref|YP_002566092.1| (Halorubrum lacusprofundi ATCC 49239)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment GHMP kinase [Halorubrum lacusprofundi ATCC 49239]
Sequence length 332
Sequence
MTEKATARAHPIQGLVKYHGMRDPELRLPYHDSISLCTAPTATTTTVEWQPDASEDVYVI
GDEEVDGRAAERIDMVVEHVRELAGVDAAVRLESENSFPSNIGFGSSSSGFAAAALALTE
AAGLDLTLPDISTVARRGSSSAARSVTGAYSRLDAGLNDEDCRSHRLDVGVGDDGFDPEE
DLRIVAAHVPAYKETEEAHREAAASHMMQARTAHVQDQLVEMTDALREGDFDRICGTAEH
DSLSLTATTMTGPAGWVYWQPETIAVFNAVRELREEGVPVYFSTDTGASVYVNTLAGHAE
EVEERIAEIGIDTDIWEVGGPAHLLDENEALF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]