dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|222480082|ref|YP_002566319.1| (Halorubrum lacusprofundi ATCC 49239)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment peptidase M28 [Halorubrum lacusprofundi ATCC 49239]
Sequence length 479
Sequence
MHSEPNETNAAVDPAAVERVRERRTELAPALGRTWTDGDPWRFLTDLTAIGSRMAGSEGE
RRAAEIVADAFERAGLSAVETRPFEMAAWERGSATLRVTAPGRDGAAATREFEALALPYS
PGGSVTGELVDVGYGTPAEIDEREVEGRIAVASTTTPEGGRFVHRMEKFGYALDAGAVGF
VFVNHLDGQLPPTGSLTFGEEAEAVAVGVSKETGAWLREYAAGGDGGVAAESSPAAQAEL
SVTATTEPGESRNVVGHAGPDTDERLLLLAHYDAHDIAEGALDNGCGIATVATAAGILTE
ADLPLGVDVVAVGAEEVGLLGSEQLAERLDLDRVKGVINVDGAGRFRDLVALAHASETAA
SVAEAVSTATNQPIAVDAEPHPFSDQWPFVRRGVPAIQLHSDSGDRGRGWGHTHADTRDK
VDDRNVREHAMLIALLVAEFAAPERDAPRLDRDDLIAAFRDADFETGMRAADLWPAGWE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]