dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|256395956|ref|YP_003117520.1| (Catenulispora acidiphila DSM 44928)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Caci_6838 [Catenulispora acidiphila DSM 44928]
Sequence length 151
Sequence
MTNIIPIGQVVGGRAEPRDDDWGGEQAVIRLDDRFGPEALAGLDAFSHLEVVYQFHLVDP
EKVQTGARHPRNNTEWPLVGIFAQRGKNRPNRIGVSRCRLVKVEGRDVHVTGLDAVDGTP
VLDLKPYMAEFGPIGEVAQPEWATELMREYY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]