dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|383753923|ref|YP_005432826.1| (Selenomonas ruminantium subsp. lactilytica TAM6421)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment putative Holliday junction ATP-dependent DNA helicase RuvB [Selenomonas ruminantium subsp. lactilytica TAM6421]
Sequence length 342
Sequence
MAEEDFYDMDIDDGRIVAMDEQRMDDWQYSLRPRKLNEYIGQDKAKKNLEIFIQAAMNRG
DALDHVLLYGPPGLGKTTLAGIIANEMGVNFRQTSGPAIERQGDLAALLTNLQEHDVLFI
DEIHRLSRSVEEVLYSAMEDFALDIIIGKGPSARSIRLDIAPFTLIGATTKAGSLAAPLR
DRFGIISRLEYYTPEALVTIVKRAAEILEIPIEDKGAMEIARRSRGTPRIANRLLKRVRD
VAQYEGKDVITDEIADKALSLLEVDKAGLDHTDRRMLLTMIKKFGGGPVGLDTLAAAISE
STDTVEDVFEPFLIQLGFINRTPRGRVVTKAGYEHLGIAYPE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]