dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|238922685|ref|YP_002936198.1| (Eubacterium rectale ATCC 33656)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein EUBREC_0260 [Eubacterium rectale ATCC 33656]
Sequence length 712
Sequence
MKQKLSVAPTLKNYDKKNLPKDILAGIIIMAVSIPISMGYAQISGLPAVYGLYGSVFPII
LFALFSTSPQFIFGVDAAPAALVGAAVLGMGIEAGSKEAMTVVPVFTFFVALWLLAFYFM
NAGKLVNYISAPVMGGFITGICTTIILMQAPKLMGSAAGTGELFELSEHIWEALHHINAA
ALVMGIVALAILVVSKRLVPKFPMAVVLMVTGALFTYFGPVKEWGVPTLSAVEPGMPRWY
IPDFEAVFSVQKASEVIVLSLSVAVVIMAETLLAENNFAQKNGYRIDDNTELLAFSIGNM
AAAFTGCCPINGSVSRTAMSEQYEGKTQLTGLVAGVSMIAVLLFCTGFIGYLPVPVLTAI
VISALMGATEFHLAKRLWKVSRTEFFIFVGAFFGVLILGTINGVLIGIILSFAEMIIRSA
KPATCFLGVQPGHSHFRDIRESTNIHEIDGVIIYRFSSGLFFANAKVLVRDIEDHLKHDT
KAVIIDAGAIGSIDITGADSIESLYRSLKQKGVKLYITEHIAELNEQLRKLGLGYLIEQG
CVRRTIHIALKDMGINRPYPLEGGVDNEERSASRKRADNRVQEFVWAFGAESEEQIEKQI
KLQIEQLKKTKDIEEIMHGRWAHMDEFDQDEWLEHLEEHLKEIVNISGKDVHTLAADIEM
HRREVHERIAREHPELAERFAQRRHLLDKHLKERRPEVYRIIVQLREDNKHK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]