dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|333979005|ref|YP_004516950.1| (Desulfotomaculum kuznetsovii DSM 6115)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment integrase protein [Desulfotomaculum kuznetsovii DSM 6115]
Sequence length 284
Sequence
MDILTSFKNSLLARGLSPGTAEIYAGHLRRFFAWVEGTYGEPDPAAVTPLDVADYRRFLQ
NRNRKPATVNNALDAIGSFFAWAKEAGIVQSDPTEGVKRLPEQKPAPKWLSRRELGALVR
AVQKYGSRRDQALVTLLLHTGLRVSEAVSLRVQDVVIRERSGHVAVRQGKGGKYREVPLN
ATARRTLGEYLATLSGEWLFPGRSGGPMTRRTAEKTLAKYARLAGVEATPHRLRHTFCKM
LVDAGESLDRVAVLAGHENMNTTARYTRPGRADLEAAVEKIAWE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]