dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|113474474|ref|YP_720535.1| (Trichodesmium erythraeum IMS101)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment putative protein serine/threonine phosphatase [Trichodesmium erythraeum IMS101]
Sequence length 733
Sequence
MLICPQCELENPDNHRYCQKCGVSLTHKNCHQCGSQVSLKALQCHNCGVYTGQVWKAIIY
YQKEVATPSIPEISVNNLSQQEFMTGEKPLDNDSLESATKIIGEESEKILESSHNLDEKI
KIEDDYQSNNTFGTSASDIEVEETQPKAIGNSDNSELTTTDILNLVCETVNTENQLSLND
TKILSTPSIEKYLDPKQRYQVLETIPVNNQGQRVVVEVLDRYPLEETPIRAWLKNNSDSF
KQITPKAMEALIIPIIAQPYIALQTQIPQNLPTIHDSWRSHSIERLRCHSKEILLLADYS
SWPRLVDLWGNQQLPQLQILSWLEQMTELWIALMPWDCCQSILEDENLRVNQVDNNYIKL
QSLYSKPGEPKTLEDLMLFWQRLFEQSQRTKFGWITALFQDWRNGEIQTIEQLRSYIMNT
QDNLQSQAPAKSAPTFLQADNSASKIPDDVETQETELLPTQLISLESSSKSDVGSQRDHN
EDAFGIQTQIESQETSIEKIIQAKGIYILCDGMGGHAGGEIASHLAVDSIKQYFQTESSW
SVGLPSEETIREAVLQANEVIYDLNQQEARSGSGRMGTTLVMAMIYDTEVAVAHVGDSRL
YRFSREGGLEQITLDHEVGQREVNRGVELQIAYGRPDAYQLTQALGPRNENFVRPDIQFL
NLKNDTLLILASDGLTDNQLLENNWQTHLKPLLDKQANLELGVSKLIDLANQYNGHDNIT
AIVIRALIKPEKD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]