dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|148826875|ref|YP_001291628.1| (Haemophilus influenzae PittGG)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment valyl-tRNA synthetase [Haemophilus influenzae PittGG]
Sequence length 954
Sequence
MTQKFEMADRFNPSAVEQALYQHWEESGYFKPSENENAPSYCIAIPPPNVTGSLHMGHAF
QQTLMDTLIRFNRMEGHNTLWQAGTDHAGIATQMVVERKIAAEEGKTRHDYGREAFINKI
WDWKAYSGGTISQQMRRLGNSIDWERERFTMDDGLSNAVKEVFVRLHEEGLIYRGKRLVN
WDPKLHTAISDLEVENKESKGSLWHFRYPLANDAKTADGKDYLVVATTRPETMLGDTAVA
VHPEDERYQSLIGKTVILPLANREIPIIADEYVDREFGTGVVKITPAHDFNDYEVGKRHN
LPMVNVLTLNANIRDEAEIIGTDGKPLAGYEATIPADYRGLERFAARKKIVADFEALGLL
DEIKPHDLKVPYGDRGGVPIEPMLTDQWYVSVKPLADVAIKAVEDGEIQFVPKQYENLYF
SWMRDIQDWCISRQLWWGHRIPAWYDAEGNVYVARNEEEVRSKYNLDSAVELKQDEDVLD
TWFSSGLWTFSTLGWPEQTKELKMFHPTDVLITGFDIIFFWVARMIMFTMHFVKDENGKP
QVPFKTVYVTGLIRDEQGQKMSKSKGNVLDPIDMIDGISLEDLLEKRTGNMMQPQLAEKI
AKATRKEFAEGIAAHGTDALRFTLAALASNGRDINWDMKRLEGYRNFCNKLWNASRFVLT
NEKLDLSQGEIEFSLADRWIQSEFNRTVETFRNSLSQYRFDLCANAIYEFTWNQFCDWYL
ELTKPVFANGNAAQIRAASQTLVHVLEKLLRLAHPLIPFITEEIWQKVKGFVDITADSIM
LQPFPQVEENCFDPEAEAEIEWLKEVIVAVRNIRAESNIAPSKGLDLLFRNLSAENAKIL
EKQTALLKAMAKLDNVQVLAANETAPLAVAKLVGNAELLVPMAGFINKEAELARLTKEIE
KYQNEVKRIENKLSNEAFVAKAPEAVIAKEREKQAEYQSGLEKIQEQYKAIEAL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]