dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|126459525|ref|YP_001055803.1| (Pyrobaculum calidifontis JCM 11548)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Anthranilate synthase [Pyrobaculum calidifontis JCM 11548]
Sequence length 357
Sequence
MEGRAYFRSDVVEVYVEGQVTWDVEEVARAVGRGEVAVGVFTFDFSPWEGVAVRRRERWP
GALFVVGRPTSPIFSRPARCRVEHLGGSGGFLGAVAAAKEALARGEVFQLVLARFEKYLV
ECPIDTVYRALAEASEGRYHFFFEAGEVALAGVSPEILARVEGRRVLSGPIGGTRPRGRT
ADEDRALEEELVSSVKERAEHIMLVDSVRNDLGRVCAWGSVRPVEVLKVEKYSYVQHLVS
YVEGVLDRFYRPIDAVLALNPTTTVVGVPKPRAMSLIDMLEEEPRGPFAGSFGVLAKDFA
DFAVVIRSVYGEGDTFYVWAGAGIVADSNPAWELRETEVKMAPAKAALRRLGSSPPP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]