dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|434395193|ref|YP_007130140.1| (Gloeocapsa sp. PCC 7428)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Ion transport 2 domain protein [Gloeocapsa sp. PCC 7428]
Sequence length 295
Sequence
MTQKKRRSSRVVRIVNKDGRLNIVGSGKWYSYWRDPYHLLLTVPWTGFLAIVTLGYITAN
TFFALAYLVGGNGIANARPGNFFDAFFFSIQTMASIGYGAMYPQTLYANILVTIESLLGL
MGLAMGTGLAFARLSQPTARVIFSRVAVVDLYDGVPTLMFRTANKRRNQILEAELRVRLA
RDEVNAEGLSMRRVYDLPLVRSQNPSFALSWTAMHPIDESSPLYKATPEILAQQEASIII
TLIGIDETVSQTIHARHVYIARDILWNMRFVDIMLRTLDGDRHLDYSRFHDVTPL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]