dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|239908936|ref|YP_002955678.1| (Desulfovibrio magneticus RS-1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment sulfate transporter family protein [Desulfovibrio magneticus RS-1]
Sequence length 643
Sequence
MVVTIHPSRRRPVEHCDLPRRPSRFEPLLRLLPRLFPFLSWWPRVGRRTLTADLWAGLTG
AVIVLPQGVAFAAIAGLPPQYGLYAAMVPVIVAALYGSSWHLISGPTTAISLVVFANVSQ
LAPPGSPDYIRLVLALTVLAGLVQFGLGLARLGGVVNFVSHSVVTGFTAGAAILIATSQL
GHFFGVTLPRGGSFLETWLAFFQQLPAVNGHVALIAGATLLVALVLRRLWPRCPALLLSL
IAGSLLCHVLNGAGHGAKLVGALPASLPPLSLPEIDLDTFRVLFPGALAVAMLGLAEAVS
IARAVAVRSEQHIDNSQEFIGQGLANIAGGFFSGYASSGSFTRTGVNFDAGAKTPLAAVF
SAVLLALVVLLVAPATAYLPIAAMAGVIVLVAAGLVNAKAIRHILRTDRSEAGVLAATFL
STLFVGLEFAIYAGVMLSLLLYLRRTSHPHFITLAPDPASSRHALVNVRRKKLAECPQLK
ILRLDGSIFFGAVNHIAEELHRIVEKSPEQCHILIIGSGINFIDAGGCHMLFHEAGAMKL
SGREIFFCSLKGEVMELLTRGGCLARIGAENVFRDKESAIAGIVARLDPERCACCPSRVF
AECAGRPGGWAEGLAAAGLAELGDGPALAEGDDDENDDAPEEG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]