dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|224475507|ref|YP_002633113.1| (Staphylococcus carnosus subsp. carnosus TM300)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase protein [Staphylococcus carnosus subsp. carnosus TM300]
Sequence length 613
Sequence
MSRFLQTLKENVLVADGAIGTILYSEGIDTCPEAYNITHPKKIEQIHRSYIQAGADVIQT
NTYGANFEKLQTFGLEHQVKDITRAAVRIAKKAANEDTFILGTVGGFKGVKQNELSLSTI
LYHTDIQIDTLIDEGVDALLFETYYDLNELLQVIRATKKKYDIPVIAQLTASNTNYLQDG
TEINEALKQVEAEGADVIGLNCHHGPHHMQQSFTHIELPQHALLSCYPNASLLDFENSSI
KYSDNASYFGKIAKSLVKEGVHLIGGCCGTTPEHIHYIKEAVEGLEPINEKKVIPIRRKS
NHPSIPVQKDNLTTKVKSGPTVIVELDTPKHLDTTKFFVNVTKLDKANVDAITLADNSLA
TVRVSNIAAASIIKQNYNIEPLVHITCRDRNLIGLQSHLLGLSLLGINEILAITGDPSKV
GHLPGANNVYDVNSKGLTELAVRFNQGLNIDGGALKTTTNFNIAGAFNPNVRKMEAAVRR
LDKKLDSGMNYFITQPVYTVEKIQEIAEKTAHLDSPFFIGIMPITSYRNAQFLHNEVPGI
TLPEDVLEQFEAVKDDKQKTKELSLRICRKLVDEVTKHFNGLYLITPFEQVDYSLELATY
FKTKTENNQEAII

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]