dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|256425407|ref|YP_003126060.1| (Chitinophaga pinensis DSM 2588)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment proline dehydrogenase [Chitinophaga pinensis DSM 2588]
Sequence length 392
Sequence
MEKQLSLSFENTAIAFESKTDKALKKADFLFTNIGKPWLVKVGAAVTPFALKIGLPIKGL
IRSTIFSQFCGGENLQEAAATASSLGKFHVGVALDYGVEAMEGEENYDHAVPEFVRAIEY
AAGNPNIPFIAIKVTGFARFSLLEKLHANETLTPEEAAEYARVRQRIQTIAATAAKHKVG
LLIDAEESWIQQPVDDLTEELMAQFNTTNAIVYNTFQMYRHDRLAFLKRSFEKAQQQGYL
LGAKLVRGAYMEKERKRAEEMGYPSPIQPDKEATDRDYNAAVTFCMERLDKLAVFVGTHN
EQSSMLAASLLHQQELPHNHPHVSFSQLLGMSDNITFNLAHAGYHVSKYLPYGPVKDVMP
YLLRRAQENTSISGQVGRELGLIRKERKRRGI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]