dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|153941165|ref|YP_001389809.1| (Clostridium botulinum F str. Langeland)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment methyl-accepting chemotaxis protein [Clostridium botulinum F str. Langeland]
Sequence length 560
Sequence
MKNKLIRQIALLFNVLILILCATFFIGTKSILKGLENNDPNLLASFSSSYLKFIAIMFII
MLAVSYIVVKVFVTKAYNSIEEVAEIIDRVSKGEFATRVPEEGILEPIGVSVNAIVRNTK
KILSDLLQISQKNRIISNTLHENALDSNQATENIASSVISVAETATTQADSTTSTRNNTS
EMAENSTVIAEKAQNTKNIAEEMVKTIKENQKTFETMIYKIKSTGDVSKKLAKNVRILES
EAEEISKITDVVTEISERTNLLALNAAIEAARAGEHGKGFSVVADEVRKLAEQSSESAGE
IRKLIEKITYQITNITEEAENQSKEVEEDIVYADESRESFNEIISSTDETYNSVEQIYDL
SDKNTTISKEVDQLMETIASGAQQSASMTEEISAAVEEQSASINEITQLIKEMNVCTDEI
DSELKAFVTNITIKREQKQLVNEGFNILEKISREINSNNLSVDACSNICKQYVEANNQFE
YIGVIDKEGIMKSANVPITKGNDDFSHRPYFKKAILGERYTSKPYISSVSYNYCIAIAIP
LKDKNGNIQAVAMGDVCIEE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]